PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G036000.1
Common NamePOPTR_0001s07330g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 569aa    MW: 62684.4 Da    PI: 4.9707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G036000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-173986148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Potri.001G036000.1 39 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                        79******************************************9986 PP

2Myb_DNA-binding53.94.2e-1792135146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Potri.001G036000.1  92 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.763486IPR017930Myb domain
SuperFamilySSF466892.28E-3038133IPR009057Homeodomain-like
SMARTSM007171.2E-153888IPR001005SANT/Myb domain
PfamPF002491.6E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-244093IPR009057Homeodomain-like
CDDcd001674.31E-124186No hitNo description
PROSITE profilePS5129426.15987141IPR017930Myb domain
SMARTSM007172.3E-1791139IPR001005SANT/Myb domain
PfamPF002494.6E-1692135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2694139IPR009057Homeodomain-like
CDDcd001671.16E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSRMTSESED GIVSNNQIES PLGEEGNYCG SANGGVLKKG PWTSAEDAIL IEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTQEEE QLIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRH QRAGLPLYPP EASLQALQES QRCLNIDRIE IRNKSQHDTL  180
QSNSYGIPNV MFDNLTPHQS ILPYVPELPD ITASSMLMKG LSSFQYGSFM SPIMHRQKRL  240
REATTLLSSF GGGMKNEFHL FDQFQDVDKA SQSFGLPFPF DYDSTTKNPE FFGENQGSHT  300
LANGNFSASK PTSEAVKLEL PSLQYSETDL GGWGPSCSPS PLIESVDTFI QSPPTGTVES  360
DCPSPRNSGL LDALLHEAKT LSSAKNQLSD KSSNSSTVTP GDDADSSALN ICETEREDYG  420
HPISPLGHTA TSLFSECTPI SANESSLDES PSSETFTGSK RKFGRSAECY VKSEPVDQTW  480
TADREKESST WLDITSPDAL LDSDWLEHDS AYGKDQVIVT DAMGTLLCDD SSSEYKQMAA  540
GASVNHGWGH SSCSWNNMPA VYQMYELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32371395106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346482e-92KM034648.1 Jatropha curcas clone JcMYB028 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368652.10.0hypothetical protein POPTR_0001s07330g
TrEMBLU5GS350.0U5GS35_POPTR; Uncharacterized protein
STRINGPOPTR_0001s07330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-136myb domain protein 33